Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY537500.1 | internal | 165 | 1-495(+) |
Amino Acid sequence : | |||
SDPRLLQLAEKLEDSVLHNLRLSSSDSILSKSWPTRRDDPFRYTDLSLLKFYILDGHVLPNGVYVGGIGDLFWDLNGIGAPDVAVVYVPEGCREEPLHLKYRLAVSNPRVLVVVERGGEI GIVEEYWANSVAEVAIGEGGRVSHSYVQRQELGSAHTKWTLVQQG | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 12,627.183 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 121.210 | ||
aromaticity | 0.017 | ||
GRAVY | -1.424 | ||
Secondary Structure Fraction | |||
Helix | 0.087 | ||
turn | 0.435 | ||
sheet | 0.148 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY537500.1 | 5prime_partial | 115 | 493-146(-) |
Amino Acid sequence : | |||
PAALRSTWYVPNPTPASARKSATPSRPPRSQPPPPNSPNTLQQSQSLPLSPRQPKPLDLTPPTGTSSAMAPPGNPPARTRPPRQAHQSHSSPRRGRRCRRRRRRLGGRGRRGCRT* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,627.183 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 121.210 | ||
aromaticity | 0.017 | ||
GRAVY | -1.424 | ||
Secondary Structure Fraction | |||
Helix | 0.087 | ||
turn | 0.435 | ||
sheet | 0.148 |