Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY537548.1 | internal | 344 | 1-1032(+) |
Amino Acid sequence : | |||
SDPFVLQLAEALEDSLLQKLRDTSSETLLSAPWPSRKDEPFRYTDTSFIKLDIVDGYMLPIGVFVGSLRDLFWSINGIGAPDLTVVYVPEGCKVENPIHLRYKLPISNPRVFVLVEKGGE IGIIEEFYWTNSVLEVIVREGGKITHSYIQKQSLSAAHIKWTSIQQESASTYELIEVSTGGKLSRHNLHIMQVGPDTVTELSSLHLDQTQDLHSRLVLDHPRGYSRQLHKSIVSHSLGQA VFDGNVQVNRYAQQTDAGQLTRSLLLEPRATVNVKPNLQIIADNVKCSHGAAISDLEESQLFYFQARGIDLQTARKALVLSFGNEVFQRIPVRKEVENNIKELL | |||
Physicochemical properties | |||
Number of amino acids: | 344 | ||
Molecular weight: | 38,598.430 | ||
Theoretical pI: | 5.895 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37025 | ||
Instability index: | 35.522 | ||
aromaticity | 0.076 | ||
GRAVY | -0.188 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.233 | ||
sheet | 0.241 |