Acc_NO	ORF type	length	start-end position (strand +/-)
>KY537775.1	internal	134	1-402(+)
Amino Acid sequence :
NLSIKAATVASQWLELLQQDIKGRLSALKRSKKRVRVVISTELPFLIEKEFPIDKENEHSYADMHRARWSSLFDQMDKALSEEEKQLETWSNQVKQMQLHCEQGLQLSHIQQMGDEADKE LAVRAAAASIYSTC
Physicochemical properties
Number of amino acids:		134
Molecular weight:		15,401.358
Theoretical pI:		6.110
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19605
Instability index:		56.567
aromaticity		0.060
GRAVY		-0.556
Secondary Structure Fraction
Helix		0.269
turn		0.157
sheet		0.336