Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY538614.1 | internal | 216 | 1-648(+) |
Amino Acid sequence : | |||
SGSPLPGVKIPKETIDMLKNQVFGFDTFFVTAQDPYEGGVLFKGNLRGQAAKSYEKITKRMFGDEYKVFFLINPEDDRPVAVVVPKRTLQPETAVPEWFAAGAFGLVTVFTLLLRNVPAL QSNLLSTFDNLELLKDGAPGALITALILGVHELGHIIAAGVKLGVPYFVPSWQIGSFGAITRIINIVGKREDLLKVAAAGPLAGFFFGLFFFLLGF | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 17,258.964 | ||
Theoretical pI: | 11.309 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 55.431 | ||
aromaticity | 0.062 | ||
GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.340 | ||
sheet | 0.179 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY538614.1 | 5prime_partial | 162 | 647-159(-) |
Amino Acid sequence : | |||
NPKRKKKSPKKNPANGPAAATFKRSSRLPTIFIILVIAPKEPICQLGTKYGTPSLTPAAIMWPSSCTPRMRAVIRAPGAPSFNNSRLSKVDNKLDCNAGTFLRSKVNTVTSPKAPAANHS GTAVSGCRVRFGTTTATGRSSSGLIKKKTLYSSPNILFVIFS* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,258.964 | ||
Theoretical pI: | 11.309 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 55.431 | ||
aromaticity | 0.062 | ||
GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.340 | ||
sheet | 0.179 |