Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY538722.1 | internal | 119 | 1-357(+) |
Amino Acid sequence : | |||
CTSGSGCSCLDNRTEIHSGECSKPQSGDFCSVGLARSNFRILKRKGIELPYKELTSYERTLSLEQCESFCEKNCSCWGAVYNNASGFCYMLDYPIQTLLRVGDESKMGYFKVKEDPHRR | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,461.114 | ||
Theoretical pI: | 7.635 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 15065 | ||
Instability index: | 55.366 | ||
aromaticity | 0.101 | ||
GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.277 | ||
sheet | 0.210 |