Acc_NO	ORF type	length	start-end position (strand +/-)
>KY538722.1	internal	119	1-357(+)
Amino Acid sequence :
CTSGSGCSCLDNRTEIHSGECSKPQSGDFCSVGLARSNFRILKRKGIELPYKELTSYERTLSLEQCESFCEKNCSCWGAVYNNASGFCYMLDYPIQTLLRVGDESKMGYFKVKEDPHRR
Physicochemical properties
Number of amino acids:		119
Molecular weight:		13,461.114
Theoretical pI:		7.635
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		14440 15065
Instability index:		55.366
aromaticity		0.101
GRAVY		-0.562
Secondary Structure Fraction
Helix		0.252
turn		0.277
sheet		0.210