| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY538896.1 | internal | 476 | 1-1428(+) |
Amino Acid sequence : | |||
| HLRIVAPHVAGYVWQHEPFRLSPHLHGRTRYGDNVEDEWFVVFLLYEATRAVPSVSARVWDSDGEFLLIEAAFSIPRWLEPDSSANRVFVRGGELHIVPLVDSLVQAAVNRRLGGYPEKA RSNVHNVRVRVPVPVAQVLKHEPCLVSLAVEGFYDRDVDSMKFASKMERFEETVRVSVRMSRAMYAQLMRQAFQAPRGYPYREAETGMKIACGFEMMYQQRKREGAEGKGKGWKAFLESL ERSGYFEGLLPGSKEYKRRMEEALEYHRSTAFFAQTGETLSAPVRRIDEILALPHSVDDFEGLDLPPDDDDSWLYNGEDELNSAILERQKEMETYERKKHQKSKDFNLGEITKTMQAFVQ KVSSFEGAEVPENSDSKAVEFDVERFIRDMESVVNVDEDDLSDMDYDDFMSSYSDALNKELNETTLKKSFIRATFTPVDVDVNLVKSILDSFSSQQGLPGPASNLLGLMGVKLPQD | |||
Physicochemical properties | |||
| Number of amino acids: | 476 | ||
| Molecular weight: | 10,494.919 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 133.034 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.028 | ||
| turn | 0.611 | ||
| sheet | 0.102 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY538896.1 | 3prime_partial | 295 | 885-1(-) |
Amino Acid sequence : | |||
| MRQSKYLINASYWSTQCLTCLSKKGGATMVLQRLLHPPLVLFRSRKQPFKVTTPLQTLQKRLPSLPLPFRPLPLPLLIHHLKPTSDLHPRLRLPIRIPPRCLERLPHELRVHRPRHPHRN PNCLLKSLHLRRKLHRIDVPVVKPLHRERHQARLVLEHLRHGHRNPNPNVMDVRPRFLGVPAQPPIHRRLHQRIDEGDDVEFPSADEDAVGAAVGLEPPGDGERRLDEEELAVGVPDAGG DGGDGPGGLVEEEDHEPLVLDVVSVPRPPVEVGGEAERLVLPDVAGDVGGDDAEV | |||
Physicochemical properties | |||
| Number of amino acids: | 295 | ||
| Molecular weight: | 10,494.919 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 133.034 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.028 | ||
| turn | 0.611 | ||
| sheet | 0.102 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY538896.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
| PPHRRPPRRRLRLAARAVPPLPPPPRADEVRRQRRGRVVRGLPPLRGHPGRPLRLRPRLGLRRRVPPHRGGVLHPPVARARQQRQPRLRPRRGTPHRPPRRFAGAGGGESEAGRVPRESE VERP* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 10,494.919 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 133.034 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.028 | ||
| turn | 0.611 | ||
| sheet | 0.102 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY538896.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| TSASSPPTSPATSGSTSRSASPPTSTGGRGTETTSRTSGSWSSSSTRPPGPSPPSPPASGTPTASSSSSRRRSPSPGGSSPTAAPTASSSAEGNSTSSPSSIRWCRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 10,494.919 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 133.034 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.028 | ||
| turn | 0.611 | ||
| sheet | 0.102 | ||