Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY540192.1 | internal | 312 | 1-936(+) |
Amino Acid sequence : | |||
EEGVMATDFFWSYTDEPHASRRRQILSEYPQIKELFGPDPWAFLKITAVVLLQLWTATHLQDSGWLKMLLVAYFFGSFLNHNLFLAIHELSHNLAFSTPSHNRWLGIFANLPIGVPMSVT FQKYHLEHHRFQGVDGLDMDIPSQAEAHAVTNTISKSIWVMFQLFFYALRPLFLNPKPPGLWEFINLVVQISLDLAMVYFWGWRSLAYLILSTFVGGGMHPMAGHFISEHYVFKPDQETY SYYGPLNLLTWSVGYHNEHHDFPRIPGSKLYKVKEMAPEYYERFSSYRSWSQVIYMYIMDRTVGPFSRMKRK | |||
Physicochemical properties | |||
Number of amino acids: | 312 | ||
Molecular weight: | 21,195.183 | ||
Theoretical pI: | 11.557 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
Instability index: | 87.230 | ||
aromaticity | 0.021 | ||
GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.318 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY540192.1 | 5prime_partial | 192 | 3-581(+) |
Amino Acid sequence : | |||
RRGDGDGLLLVLHRRAPRVAKASDPLRVPTNQGALRTRSLGLPQDHCSSPASAMDCDSSPGLRLAEDVAGCILLRILSQPQPLPRHSRAQPQPRLLHSFPQPLVRHLRQPPHRCPHVCHL PKVPPRAPPLPRRRWPRHGHPKPSRSPRSHQHHLQIHLGHVSALLLCSASSLPQPEATWIVGVHQSGGSDFS* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 21,195.183 | ||
Theoretical pI: | 11.557 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
Instability index: | 87.230 | ||
aromaticity | 0.021 | ||
GRAVY | -0.582 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.318 | ||
sheet | 0.219 |