Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY541003.1 | internal | 268 | 1-804(+) |
Amino Acid sequence : | |||
YTPFNRRNLLKILTLSTTLLSDISLNPISTPVADARGLFQMPPIRLVNRYFLMRAGESEYEKLGIINTNPVAKTSVDNGLSEKGKNQTIKAAFELKKLGACEKSCWIWPSITQRAYQAAE IIASVNGVNQSNIVPEYSFLDARGLGSYEGKKLEAVSEVYASDSLSLTLKPPPIDDGTPNESVADVFVRVTQLMSILETQYSGDTVIIVSPDSDNLTILQAGLIGLDLRRHSELSFAPGE VRFVDTSSIPEYKQPASAVYKCLNPPNC | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 29,377.155 | ||
Theoretical pI: | 5.393 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26150 | ||
Instability index: | 34.786 | ||
aromaticity | 0.075 | ||
GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.280 | ||
sheet | 0.250 |