Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY541075.1 | internal | 271 | 1-813(+) |
Amino Acid sequence : | |||
PKPANPNHLPNPTTNRRLLLLSTASIPLIHPISAASAGGLFQMPPARLTNRYYLVRAGESEFERLGTINTNPVAKTSMDSGLSEEGKEQTLAAAVSLRRAGACGGSCWIWPSITQRAYQT AEIIAAVNGIDRSHIVPEYSFLDARGLGAFEGQSLDSVSEVYASDSISPNIKPPPMYDGTPNESVSDVFVRVTQLMSVIETQYSGDTIVIISPDSDNLTILQAGLIGLDLRRHRELSFRP GEVRYVDASSIPKYKQPASAVYKCTNPPSCK | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 12,616.773 | ||
Theoretical pI: | 7.308 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 68.112 | ||
aromaticity | 0.008 | ||
GRAVY | -1.053 | ||
Secondary Structure Fraction | |||
Helix | 0.158 | ||
turn | 0.383 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY541075.1 | 5prime_partial | 154 | 2-466(+) |
Amino Acid sequence : | |||
QNQRIPTTSQTPPPTAASFSSPPPPSPSSIPSPPPQPAASFRCRPPASPTGTTLSGRGSRSSRDWGRSTRTRSRRRRWTAASRRRGRSRHWRPRSRSGGRGRAAAAAGSGRLSRRGRIRR LRLSRPLMALIGAILCQNTAFWMPVAWEHSRDKV* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 12,616.773 | ||
Theoretical pI: | 7.308 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 68.112 | ||
aromaticity | 0.008 | ||
GRAVY | -1.053 | ||
Secondary Structure Fraction | |||
Helix | 0.158 | ||
turn | 0.383 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY541075.1 | complete | 132 | 752-354(-) |
Amino Acid sequence : | |||
MLLASTYLTSPGLNDSSRCLRRSSPMRPACKIVRLSESGDMITMVSPEYWVSMTDMSCVTRTNTSETLSFGVPSYIGGGLMFGDMLSDAYTSETESRLCPSNAPRPRASKKLYSGTIWLR SMPLTAAIISAV* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 12,616.773 | ||
Theoretical pI: | 7.308 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 68.112 | ||
aromaticity | 0.008 | ||
GRAVY | -1.053 | ||
Secondary Structure Fraction | |||
Helix | 0.158 | ||
turn | 0.383 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY541075.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
KTSESQPPPKPHHQPPPPSPLHRLHPPHPSHLRRLSRRPLSDAARPPHQPVLPCPGGGVGVRETGDDQHEPGREDVDGQRPLGGGEGADTGGRGLAQAGGGVRRQLLDLAVYHAEGVSDG * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,616.773 | ||
Theoretical pI: | 7.308 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 68.112 | ||
aromaticity | 0.008 | ||
GRAVY | -1.053 | ||
Secondary Structure Fraction | |||
Helix | 0.158 | ||
turn | 0.383 | ||
sheet | 0.200 |