| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY541165.1 | internal | 513 | 1-1539(+) |
Amino Acid sequence : | |||
| PIFSEGRDGDDAHLVCPGCGVFMQDKDPDLPGFYRPVSVEIEGLDWDSEDEEELDGFTPAGPGFGNITEEWLEKRKKVKVSKSEKKRKVREAKRREDVVVCARCHSLRNYGQVKNENAEN LIPDFDFDRLITARLMKPTSTAAVVVMVVDVVDFDGSFPKRAAKSLFKALEGNKKELKHEKLPKLVLVATKVDLLPSQVSPTRLDRWVRNRAKAGGAPKLSGVYLVSAHKDLGVRNLLSF IKGLAGPRGNVWVIGAQNAGKSTLINAFAKKEGVKITRLTEAAIPGTTLGILRIGGILPAKAKMYDTPGLLHPYLVTMRLNREEHKMVEIRKELQPRTYRIKAGQTVHVGGLMRLDLTHA SVETIYVTVWASPNISLHLGKTENAEETWRKHVGIRLQPPIGQDRASELGEWKSKEFNVSGISWDVNSVDMAVSGLGWFSLGLKGDANLTLWTFGDVEVTLRDPLVTDRARFLERPGFWL PKAISEAIGHQTRLEAQLKKVEEERESSFEEVS | |||
Physicochemical properties | |||
| Number of amino acids: | 513 | ||
| Molecular weight: | 12,211.319 | ||
| Theoretical pI: | 5.403 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 50.114 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.435 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY541165.1 | 3prime_partial | 179 | 537-1(-) |
Amino Acid sequence : | |||
| MFQLLLVPFQRLEQRLRRPFGERPIKVHNIHHHNHDRCSTGRLHQSGGDQPIKIKVRNQILRILILHLPIVPQRVTPGADHDVLSPFSLSDLPLLLRLRNLHLLSLLQPLFSDVSETRPR RSETIQLFFVFAVPIKTLNFDRYGPIKPGQVGVFVLHEHAAAGADEVSIVAVPAFAEDG | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 12,211.319 | ||
| Theoretical pI: | 5.403 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 50.114 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.435 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY541165.1 | 5prime_partial | 115 | 1538-1191(-) |
Amino Acid sequence : | |||
| LTSSKELSLSSSTFFSCASSLVWWPMASDMAFGNQNPGLSRNLALSVTNGSRSVTSTSPNVHNVRLASPLSPNENQPSPDTAISTLFTSQLIPDTLNSLDFHSPNSDARSWPIGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,211.319 | ||
| Theoretical pI: | 5.403 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 50.114 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.435 | ||
| sheet | 0.209 | ||