Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY541646.1 | internal | 199 | 1-597(+) |
Amino Acid sequence : | |||
KFPRMKVWDPYKRLGVSHDASEEEIWGSRNFLLQQYAGHESSVESIEGAFEKILSSSFQNRKKTKINLKTRLKKKVEESPPWIKNLLNFVELPPVEVILRRLFLFSFMAAWSIMNSAEGG PAFQVAVSLAACIYFLNDKTKSLARAFIIGFGALVGGWICGSLLVPTIPSVLLSPTWTLELLTSLVVYFFLFLACTFLK | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 22,485.180 | ||
Theoretical pI: | 9.404 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38960 39085 | ||
Instability index: | 48.466 | ||
aromaticity | 0.131 | ||
GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
Helix | 0.397 | ||
turn | 0.236 | ||
sheet | 0.286 |