Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY541728.1 | internal | 199 | 1-597(+) |
Amino Acid sequence : | |||
KFTRMHVRDPYKRLGVTLDASEEEIRGARNFLLEEYAGHERSMESIEAAYEKILMASFQKRKKSKINLRSHIKQKVEESPPWFKKLLEFFEIPPTEVILRRAFLFAFMGAWSVMNSAEAG PAFQVAISLAACVYFLNDKMKSLGRACIMGFGALAVGWVCGSIVVPMIPTFLLQPTWTLELLTSLVCYVFLFLACTFLK | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 22,674.598 | ||
Theoretical pI: | 9.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
Instability index: | 56.361 | ||
aromaticity | 0.126 | ||
GRAVY | 0.229 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.181 | ||
sheet | 0.332 |