Acc_NO	ORF type	length	start-end position (strand +/-)
>KY541728.1	internal	199	1-597(+)
Amino Acid sequence :
KFTRMHVRDPYKRLGVTLDASEEEIRGARNFLLEEYAGHERSMESIEAAYEKILMASFQKRKKSKINLRSHIKQKVEESPPWFKKLLEFFEIPPTEVILRRAFLFAFMGAWSVMNSAEAG PAFQVAISLAACVYFLNDKMKSLGRACIMGFGALAVGWVCGSIVVPMIPTFLLQPTWTLELLTSLVCYVFLFLACTFLK
Physicochemical properties
Number of amino acids:		199
Molecular weight:		22,674.598
Theoretical pI:		9.114
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29450 29700
Instability index:		56.361
aromaticity		0.126
GRAVY		0.229
Secondary Structure Fraction
Helix		0.362
turn		0.181
sheet		0.332