| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY622016.1 | internal | 148 | 3-446(+) |
Amino Acid sequence : | |||
| PEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSK TFQGPPHGIQVERDKLNKYGRPLLGCTI | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,318.210 | ||
| Theoretical pI: | 5.029 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 30.891 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.223 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY622016.1 | internal | 148 | 3-446(+) |
Amino Acid sequence : | |||
| PEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSK TFQGPPHGIQVERDKLNKYGRPLLGCTI | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,318.210 | ||
| Theoretical pI: | 5.029 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 30.891 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.223 | ||
| sheet | 0.264 | ||