Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY661348.1 | internal | 166 | 1-498(+) |
Amino Acid sequence : | |||
TPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYV KTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVFA | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,366.733 | ||
Theoretical pI: | 8.828 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
Instability index: | 19.726 | ||
aromaticity | 0.108 | ||
GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.217 | ||
sheet | 0.241 |