Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY748231.1 | complete | 151 | 1-456(+) |
Amino Acid sequence : | |||
MAAASLPTICMFKSAPQRQTTGAFVKIPSSLGSVKSTSRIFGLKAKPDFKATAMAVYKVKLIGPDGDETEFEAPDDCYILDSAESAGVELPYSCRAGACSTCAGKMEKGTVDQSDGSFLD DKQMEEGYLLTCVSYPTADCVIHTHKEGDLY* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 11,676.203 | ||
Theoretical pI: | 9.854 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
Instability index: | 83.966 | ||
aromaticity | 0.049 | ||
GRAVY | -0.944 | ||
Secondary Structure Fraction | |||
Helix | 0.196 | ||
turn | 0.343 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY748231.1 | 5prime_partial | 102 | 454-146(-) |
Amino Acid sequence : | |||
SRDHPPCVCESHNPQWDRKRKSEGIPPPFVCRPETSHLIGQPSPSPFSQHKWSKLQPCTSMEARLLLTRQSPGCSNRRGPQTLSHHHRVRSVSPCIQPWQLL* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,676.203 | ||
Theoretical pI: | 9.854 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
Instability index: | 83.966 | ||
aromaticity | 0.049 | ||
GRAVY | -0.944 | ||
Secondary Structure Fraction | |||
Helix | 0.196 | ||
turn | 0.343 | ||
sheet | 0.137 |