| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY748231.1 | complete | 151 | 1-456(+) |
Amino Acid sequence : | |||
| MAAASLPTICMFKSAPQRQTTGAFVKIPSSLGSVKSTSRIFGLKAKPDFKATAMAVYKVKLIGPDGDETEFEAPDDCYILDSAESAGVELPYSCRAGACSTCAGKMEKGTVDQSDGSFLD DKQMEEGYLLTCVSYPTADCVIHTHKEGDLY* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 11,676.203 | ||
| Theoretical pI: | 9.854 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
| Instability index: | 83.966 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.944 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.343 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY748231.1 | 5prime_partial | 102 | 454-146(-) |
Amino Acid sequence : | |||
| SRDHPPCVCESHNPQWDRKRKSEGIPPPFVCRPETSHLIGQPSPSPFSQHKWSKLQPCTSMEARLLLTRQSPGCSNRRGPQTLSHHHRVRSVSPCIQPWQLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,676.203 | ||
| Theoretical pI: | 9.854 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
| Instability index: | 83.966 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.944 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.343 | ||
| sheet | 0.137 | ||