Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY748232.1 | complete | 152 | 1-459(+) |
Amino Acid sequence : | |||
MATARLPSNCVITTAPLNKKTASAFTRGSISLGSVKSITKTFGLKAKLDFRASAMATYKVKLIGADGEECEFEAPDDCYILDSAETAGVELPYSCRAGACSTCAGKMVSGSVDQSDGSFL DDNQMEQGYLLTCVSYPTSDCVIHTHKESDLY* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,298.740 | ||
Theoretical pI: | 11.014 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
Instability index: | 39.536 | ||
aromaticity | 0.072 | ||
GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.222 | ||
sheet | 0.144 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY748232.1 | internal | 153 | 459-1(-) |
Amino Acid sequence : | |||
SIQITFLVSVDHTVRSRVRNTGEQVTLLHLVIIKKRTIRLINRARHHFPSTGGASTRPARVWQLDSCSFSRVEDVTVIGGFKFTLLAISSNQFHLVCGHCRSSEIKLCFQPKSFRDALHR PQRDAASGKCTSSFFVQRCSRDHAVGRKPCSRH | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,298.740 | ||
Theoretical pI: | 11.014 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5875 | ||
Instability index: | 39.536 | ||
aromaticity | 0.072 | ||
GRAVY | -0.263 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.222 | ||
sheet | 0.144 |