Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY780111.1 | internal | 202 | 3-608(+) |
Amino Acid sequence : | |||
ASMSPQTETKASVGFKAGVKDYRLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVAGEENQFIAYVAYPLDLFEEGSVTNMFT SIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLXGVLDFT | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,093.777 | ||
Theoretical pI: | 6.202 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 30.132 | ||
aromaticity | 0.114 | ||
GRAVY | -0.269 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.229 | ||
sheet | 0.254 |