Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY780112.1 | internal | 206 | 3-620(+) |
Amino Acid sequence : | |||
ASMSPQTETKASVGFKAGVKDYRLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVAGEENQFIAYVAYPLDLFEEGSVTNMFT SIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRXGLDFTSXLF | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 22,498.241 | ||
Theoretical pI: | 6.963 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 30.364 | ||
aromaticity | 0.118 | ||
GRAVY | -0.279 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.230 | ||
sheet | 0.255 |