Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY780113.1 | internal | 203 | 2-610(+) |
Amino Acid sequence : | |||
ASMSPQTETKASVGFKAGVKDYRLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVAGEENQFIAYVAYPLDLFEEGSVTNMFT SIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTS | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,294.961 | ||
Theoretical pI: | 6.963 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 31.072 | ||
aromaticity | 0.113 | ||
GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.236 | ||
sheet | 0.251 |