| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY780113.1 | internal | 203 | 2-610(+) |
Amino Acid sequence : | |||
| ASMSPQTETKASVGFKAGVKDYRLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVAGEENQFIAYVAYPLDLFEEGSVTNMFT SIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTS | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 22,294.961 | ||
| Theoretical pI: | 6.963 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 31.072 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.236 | ||
| sheet | 0.251 | ||