| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KY951709.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
| ETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYVAYPLDLFEEGSVTNMFTSIVGNVF GFKALRALRLEDLRIPVAYVKTFQGPPHGIQSERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMR | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,115.936 | ||
| Theoretical pI: | 6.226 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 34.483 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.231 | ||
| sheet | 0.240 | ||