Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY951709.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
ETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYVAYPLDLFEEGSVTNMFTSIVGNVF GFKALRALRLEDLRIPVAYVKTFQGPPHGIQSERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMR | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 23,115.936 | ||
Theoretical pI: | 6.226 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 34.483 | ||
aromaticity | 0.115 | ||
GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |