Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KY951710.1 | internal | 211 | 2-634(+) |
Amino Acid sequence : | |||
PPTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYVAYPLDLFEEGSVTNMFTSIVG NVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQSERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFTKDDENVNSQPFMR | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 23,411.271 | ||
Theoretical pI: | 6.240 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 35.961 | ||
aromaticity | 0.114 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.237 | ||
sheet | 0.237 |