Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC050897.1 | complete | 137 | 165-578(+) |
Amino Acid sequence : | |||
MYERSNKNTCMHQKPQVRRGKCIKKGQILADGAATVGGELALGKNVLVAYMPWEGYNSEDAVLISERLVYEDIYTSFHIRKYEIQTHVTSQGPERVTNEIPHLEAHLLRNLDKNGIVMLG IKNLKGEGQNGRVKWGF* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,510.625 | ||
Theoretical pI: | 9.097 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 31.988 | ||
aromaticity | 0.073 | ||
GRAVY | -0.517 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.234 | ||
sheet | 0.248 |