Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC063624.1 | internal | 199 | 3-599(+) |
Amino Acid sequence : | |||
LCRDALFGDWVGRQAALDSGALAIAERGGKIIYIDTDKILFSGNGDTLSISLVMYERSNKNTCMHQKPQVRRGKCIKKGQILADGAATVGGELALGKNVLVAYMPWEGYNSEDAVLISER LVYEDIYTSFHIRKYEIQTHVTSQGPERVTNEIPHLEAHLLRNLDKNGIVSLGIKAPFNFFIMLKVIKGVWKKKAGGPK | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 22,061.289 | ||
Theoretical pI: | 9.186 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 25.303 | ||
aromaticity | 0.080 | ||
GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.226 | ||
sheet | 0.246 |