Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC126643.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
PLGKRCFFLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKSIL ASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAELSDSNIIDRF SRICRNISHYHSGSCKKRSLYRIKYILRLSFMK | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 32,780.252 | ||
Theoretical pI: | 10.202 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 60390 60765 | ||
Instability index: | 46.315 | ||
aromaticity | 0.150 | ||
GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
Helix | 0.418 | ||
turn | 0.231 | ||
sheet | 0.212 |