| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LC126648.1 | 3prime_partial | 269 | 13-819(+) |
Amino Acid sequence : | |||
| MFLLYIYYGSFSTNIGNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKSILASKG TSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAELSDSNIIDRFSRIC RNISHYHSGSCKKRSLYRIKYILRLFWLE | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 32,199.412 | ||
| Theoretical pI: | 10.040 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 63370 63620 | ||
| Instability index: | 46.530 | ||
| aromaticity | 0.156 | ||
| GRAVY | -0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.424 | ||
| turn | 0.238 | ||
| sheet | 0.208 | ||