| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LC126649.1 | internal | 273 | 1-819(+) |
Amino Acid sequence : | |||
| HWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKSIL ASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAELSDSNIIDRF SRICRNISHYHSGSCKKRSLYRIKYILRLSWLE | |||
Physicochemical properties | |||
| Number of amino acids: | 273 | ||
| Molecular weight: | 32,792.044 | ||
| Theoretical pI: | 10.068 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 71390 71640 | ||
| Instability index: | 46.067 | ||
| aromaticity | 0.147 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.231 | ||
| sheet | 0.212 | ||