Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC126649.1 | internal | 273 | 1-819(+) |
Amino Acid sequence : | |||
HWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKSIL ASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAELSDSNIIDRF SRICRNISHYHSGSCKKRSLYRIKYILRLSWLE | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 32,792.044 | ||
Theoretical pI: | 10.068 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 71390 71640 | ||
Instability index: | 46.067 | ||
aromaticity | 0.147 | ||
GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
Helix | 0.421 | ||
turn | 0.231 | ||
sheet | 0.212 |