| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LC374287.1 | 5prime_partial | 112 | 1-339(+) |
Amino Acid sequence : | |||
| DAVAPEAIRPRARLPGRHASRRPPSPRAQPGGWGRRLAPRAPRCAAGPNAIPGRLASRQVVVEHLNLSSQPCRRAVPYGHPQTTQRCTSRTASHLRPRPRVRRDYPLSLSIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,711.213 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 71.073 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.936 | ||
Secondary Structure Fraction | |||
| Helix | 0.189 | ||
| turn | 0.330 | ||
| sheet | 0.160 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LC374287.1 | 5prime_partial | 106 | 2-322(+) |
Amino Acid sequence : | |||
| TQLRPKPLGRGHACLGVTHRVAPHPRAHSRAVGGGDWPPVRLGARPAQMRSPGGWRHDKWWLNISISPRSRAAVPSRTGIHKRPNGARREQRLTFDRDPGSGGITR* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,711.213 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 71.073 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.936 | ||
Secondary Structure Fraction | |||
| Helix | 0.189 | ||
| turn | 0.330 | ||
| sheet | 0.160 | ||