Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC374287.1 | 5prime_partial | 112 | 1-339(+) |
Amino Acid sequence : | |||
DAVAPEAIRPRARLPGRHASRRPPSPRAQPGGWGRRLAPRAPRCAAGPNAIPGRLASRQVVVEHLNLSSQPCRRAVPYGHPQTTQRCTSRTASHLRPRPRVRRDYPLSLSIS* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 11,711.213 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
Instability index: | 71.073 | ||
aromaticity | 0.047 | ||
GRAVY | -0.936 | ||
Secondary Structure Fraction | |||
Helix | 0.189 | ||
turn | 0.330 | ||
sheet | 0.160 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC374287.1 | 5prime_partial | 106 | 2-322(+) |
Amino Acid sequence : | |||
TQLRPKPLGRGHACLGVTHRVAPHPRAHSRAVGGGDWPPVRLGARPAQMRSPGGWRHDKWWLNISISPRSRAAVPSRTGIHKRPNGARREQRLTFDRDPGSGGITR* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,711.213 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
Instability index: | 71.073 | ||
aromaticity | 0.047 | ||
GRAVY | -0.936 | ||
Secondary Structure Fraction | |||
Helix | 0.189 | ||
turn | 0.330 | ||
sheet | 0.160 |