Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC374288.1 | internal | 270 | 810-1(-) |
Amino Acid sequence : | |||
SEILVQTLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHY IRYQRKSILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAEL SDSNIIDRFSRICRNISHYHSGSCKKRSLY | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 32,260.352 | ||
Theoretical pI: | 10.015 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 64400 64650 | ||
Instability index: | 49.092 | ||
aromaticity | 0.141 | ||
GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
Helix | 0.415 | ||
turn | 0.233 | ||
sheet | 0.211 |