| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LC374288.1 | internal | 270 | 810-1(-) |
Amino Acid sequence : | |||
| SEILVQTLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHY IRYQRKSILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVLGHPISKPIRAEL SDSNIIDRFSRICRNISHYHSGSCKKRSLY | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 32,260.352 | ||
| Theoretical pI: | 10.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 64400 64650 | ||
| Instability index: | 49.092 | ||
| aromaticity | 0.141 | ||
| GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.233 | ||
| sheet | 0.211 | ||