Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC385925.1 | internal | 271 | 3-815(+) |
Amino Acid sequence : | |||
DVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRANLWLVEEPCMHYIRYQRKSILASKG TSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLITELAKAKFCNVLGHPISKPIRAELSDSNIIDRFSRIC RNISHYHSGSCKKRSLYRIKYILPTSLVLEL | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 32,339.530 | ||
Theoretical pI: | 9.987 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 60390 60640 | ||
Instability index: | 47.114 | ||
aromaticity | 0.140 | ||
GRAVY | -0.040 | ||
Secondary Structure Fraction | |||
Helix | 0.421 | ||
turn | 0.236 | ||
sheet | 0.214 |