Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC387636.1 | complete | 343 | 1-1032(+) |
Amino Acid sequence : | |||
METPKAELSKEELEIHGRSWNYLCSYFGPMSLKCATELGIPAIIVGSHGKPITLSDLVSKLPIHPTKSDHLRRLMHMLVNSGFLTLQRDNNGEDAYLPTTFLRYFVSNNVKGFLPLDPLM LTPLNHLSEWFQGDERRHFHTVHGESLWDVMARHPGLQSKFNEDMERDTRVMMGLIIAECRGVFEGVNTLVDVGGATGTSARMISDAFPNIRCTVLDQPHVVASAPDHARVKYVGGDMFE HIPPADVIFLKWILHDWNDEECVKILKQCKEAIPSREDGGKVILVEMVDKGAEIQALWDVMMMMLGGKERSEFEWHKLFIDAGFTDYKITPILGTRSIIEVYP* | |||
Physicochemical properties | |||
Number of amino acids: | 343 | ||
Molecular weight: | 12,711.503 | ||
Theoretical pI: | 10.378 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 63.525 | ||
aromaticity | 0.087 | ||
GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.357 | ||
sheet | 0.157 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC387636.1 | 5prime_partial | 126 | 3-383(+) |
Amino Acid sequence : | |||
GNPKSRVVQRRVRNSWSFMELPLQLLRTHVSKMRNRARNPCNHRRQPRQTNHPLRPSLQTPHPPHQIRPPPPPDAHVGELRIPHLTKGQQWRGRLPPDHLFEVFRLEQRQGLPPARPAHA DPIKPP* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 12,711.503 | ||
Theoretical pI: | 10.378 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 63.525 | ||
aromaticity | 0.087 | ||
GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.357 | ||
sheet | 0.157 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC387636.1 | complete | 115 | 632-285(-) |
Amino Acid sequence : | |||
MFGNASEIILADVPVAPPTSTSVFTPSNTPRHSAMMSPIITRVSLSISSLNFDCNPGCRAITSHKDSPCTVWKWRRSSPWNHSLRWFNGVSMSGSSGRKPLTLFETKYLKKVVGR* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,711.503 | ||
Theoretical pI: | 10.378 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 63.525 | ||
aromaticity | 0.087 | ||
GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.357 | ||
sheet | 0.157 |