Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC435407.1 | internal | 253 | 2-760(+) |
Amino Acid sequence : | |||
KDASCLHLLRVFLYEYRNCNSLLTKKSVSNFLKRNKRLFFFLYNSHAYEYQSIFVFLRNQSFHLRSISSGALFTRVYFYGKIDYLQKVFTKHFKGILWFFKHPFLHYVRYQGKWILASKS KGTSLLMTKWKYYLVHFWQCHFSVWSQPRRIHINRLSNHPIDFMGFVFSVRLTPSVVRSQMLENSFLIENGIKKFDTLVPIGPLIRSLAKAKFCNVLGHPVSKPVWSDLSDSDIIDRFVR ICRNLSHYYSGSS | |||
Physicochemical properties | |||
Number of amino acids: | 253 | ||
Molecular weight: | 30,099.771 | ||
Theoretical pI: | 10.110 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 54110 | ||
Instability index: | 41.522 | ||
aromaticity | 0.174 | ||
GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
Helix | 0.415 | ||
turn | 0.233 | ||
sheet | 0.166 |