| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LC435407.1 | internal | 253 | 2-760(+) |
Amino Acid sequence : | |||
| KDASCLHLLRVFLYEYRNCNSLLTKKSVSNFLKRNKRLFFFLYNSHAYEYQSIFVFLRNQSFHLRSISSGALFTRVYFYGKIDYLQKVFTKHFKGILWFFKHPFLHYVRYQGKWILASKS KGTSLLMTKWKYYLVHFWQCHFSVWSQPRRIHINRLSNHPIDFMGFVFSVRLTPSVVRSQMLENSFLIENGIKKFDTLVPIGPLIRSLAKAKFCNVLGHPVSKPVWSDLSDSDIIDRFVR ICRNLSHYYSGSS | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 30,099.771 | ||
| Theoretical pI: | 10.110 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 54110 | ||
| Instability index: | 41.522 | ||
| aromaticity | 0.174 | ||
| GRAVY | -0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.233 | ||
| sheet | 0.166 | ||