Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC435408.1 | internal | 184 | 1-552(+) |
Amino Acid sequence : | |||
FVGFKAGVKDYKLTYYTPDYQTLDTDILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAXYEXL | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 20,141.649 | ||
Theoretical pI: | 6.932 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 28.169 | ||
aromaticity | 0.126 | ||
GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.231 | ||
sheet | 0.247 |