| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LC435408.1 | internal | 184 | 1-552(+) |
Amino Acid sequence : | |||
| FVGFKAGVKDYKLTYYTPDYQTLDTDILAAFRVTAQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAXYEXL | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 20,141.649 | ||
| Theoretical pI: | 6.932 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 28.169 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.252 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.231 | ||
| sheet | 0.247 | ||