Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC461782.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
KDVSSLHLLRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSYGVLLERIYFYIKIEHLVNVFVKDFRANLWLIEEPCMHYIRYQGKSILASKGTS LFMNKWKFYLVTSWEWHFLVWFHPRRICINQFSKHSLEIFGYLSNVQTGPSVVRSQILENAFLINNAIKKLDTLVPIIPLIAKLAKEKFCNVLGHPISKPIWADLSDSNIIDRFGRICRN IS | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 28,586.100 | ||
Theoretical pI: | 9.695 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48275 | ||
Instability index: | 40.826 | ||
aromaticity | 0.149 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.426 | ||
turn | 0.227 | ||
sheet | 0.194 |