Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LC461783.1 | internal | 184 | 1-552(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYXIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 20,305.980 | ||
Theoretical pI: | 7.553 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 24.478 | ||
aromaticity | 0.120 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.224 | ||
sheet | 0.240 |