Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LQ606055.1 | 5prime_partial | 217 | 1-654(+) |
Amino Acid sequence : | |||
TTAAAPPSLSIPPPQSNQICRRSPMFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVD AYDKERFAESKKELDALLSDEALATVPFLILGNKIDIPYAASEDELLYHLGLTGVTTGKGKVNLSDSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIN* | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 24,379.825 | ||
Theoretical pI: | 6.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37025 | ||
Instability index: | 37.427 | ||
aromaticity | 0.111 | ||
GRAVY | -0.127 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.212 | ||
sheet | 0.272 |