Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LQ607181.1 | complete | 200 | 169-771(+) |
Amino Acid sequence : | |||
MPPPPGSPCPPSGCRASPRPPYLDGSAPGDFGFDPLRLGEVPENLERYKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILVIEFLSIAFVEHQ RSMEKDPEKKKYPGHSTLSDTPRTPRSSRSSKSRRSRMVVLPCWHSWDSACSNQRTREPDHWRIWRRIWLTRGTTTLAMS* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 10,940.630 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 67.672 | ||
aromaticity | 0.058 | ||
GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
Helix | 0.194 | ||
turn | 0.388 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LQ607181.1 | complete | 148 | 339-785(+) |
Amino Acid sequence : | |||
MGYARRPRDPGARGFGPGQLGQGAGVGCTAGWAGDLLGQPGAMGHPSHHLGDRVLVHSLCRAPKEHGEGSGEEEVPGAFDPLGYSKDPKKFEELKVKEIKNGRLALLAFVGFCVQQSAYP GTGPLENLASHLADPWHNNIGDVLIPLS* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 10,940.630 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 67.672 | ||
aromaticity | 0.058 | ||
GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
Helix | 0.194 | ||
turn | 0.388 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LQ607181.1 | complete | 118 | 757-401(-) |
Amino Acid sequence : | |||
MLLCHGSAKCDAKFSNGPVPGYADCCTQNPTNASRARRPFLISLTLSSSNFLGSLEYPRGSNAPGTSSSPDPSPCSFGALQRLWTRTRSPRWWEGCPMAPGCPSRSPAHPAVQPTPAP* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 10,940.630 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 67.672 | ||
aromaticity | 0.058 | ||
GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
Helix | 0.194 | ||
turn | 0.388 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LQ607181.1 | 5prime_partial | 103 | 3-314(+) |
Amino Acid sequence : | |||
TRPWLSLRPKAKPLIPSPTMAANTLMSCGVAAAAICPSVLSSSKSKFAASVSFGTNATTSRFSMSAEWMPGEPPPTLPRRLSSGRFRIRPTSPRGSPGKPREI* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,940.630 | ||
Theoretical pI: | 11.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 67.672 | ||
aromaticity | 0.058 | ||
GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
Helix | 0.194 | ||
turn | 0.388 | ||
sheet | 0.243 |