Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LQ607827.1 | 5prime_partial | 186 | 3-563(+) |
Amino Acid sequence : | |||
LGCHSKKKHTQRLKKIAKNKKFAMALRMWASSTANALRLSTCASKSPAFSLSRAFSTVLDDLKYASSHEWVKHDGGVATIGITDHAQEHLGEVVFVELPESGKEVKQGSGFGAVESVKAT SDVNSPISGEVVEVNTKLTDSPGLINTSPYEDGWMIKVKPTNPSDLGNLMGSKEYTKFCEEEDAAH* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,138.527 | ||
Theoretical pI: | 7.208 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 34.283 | ||
aromaticity | 0.065 | ||
GRAVY | -0.424 | ||
Secondary Structure Fraction | |||
Helix | 0.247 | ||
turn | 0.263 | ||
sheet | 0.258 |