| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LY581230.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
| TEFDADWLQVIGKLYTKPVVTVGLLPPEEVQIDMSWASAFKWLDLQAAKSVVYVAFGSEAKLTVEQVGEIALGLESSGLKFIWTLRADGLPRGFEERTKDRGMVCKGWIPQTRFLAHSSV GGFLTHGGSSSIVEGLSFGLVMVVLPLLWGQGLNARYLVDKKVGVEVPRNEE | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 11,615.084 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 84.207 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.270 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LY581230.1 | 5prime_partial | 100 | 518-216(-) |
Amino Acid sequence : | |||
| LLISRHLDPNFLVHQIPSIEPLAPQQWQHHHHQPEREPLDYRARPAMCQEPTDRRMSQEPSLWNPALANHSPVLCPLLETPRQAVGPQSPYKFQPARLEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,615.084 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 84.207 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.270 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LY581230.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
| TEFDADWLQVIGKLYTKPVVTVGLLPPEEVQIDMSWASAFKWLDLQAAKSVVYVAFGSEAKLTVEQVGEIALGLESSGLKFIWTLRADGLPRGFEERTKDRGMVCKGWIPQTRFLAHSSV GGFLTHGGSSSIVEGLSFGLVMVVLPLLWGQGLNARYLVDKKVGVEVPRNEE | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 11,615.084 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 84.207 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.270 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >LY581230.1 | 5prime_partial | 100 | 518-216(-) |
Amino Acid sequence : | |||
| LLISRHLDPNFLVHQIPSIEPLAPQQWQHHHHQPEREPLDYRARPAMCQEPTDRRMSQEPSLWNPALANHSPVLCPLLETPRQAVGPQSPYKFQPARLEP* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,615.084 | ||
| Theoretical pI: | 6.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 84.207 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.270 | ||
| sheet | 0.280 | ||