Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LY581230.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
TEFDADWLQVIGKLYTKPVVTVGLLPPEEVQIDMSWASAFKWLDLQAAKSVVYVAFGSEAKLTVEQVGEIALGLESSGLKFIWTLRADGLPRGFEERTKDRGMVCKGWIPQTRFLAHSSV GGFLTHGGSSSIVEGLSFGLVMVVLPLLWGQGLNARYLVDKKVGVEVPRNEE | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 11,615.084 | ||
Theoretical pI: | 6.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 84.207 | ||
aromaticity | 0.060 | ||
GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.270 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LY581230.1 | 5prime_partial | 100 | 518-216(-) |
Amino Acid sequence : | |||
LLISRHLDPNFLVHQIPSIEPLAPQQWQHHHHQPEREPLDYRARPAMCQEPTDRRMSQEPSLWNPALANHSPVLCPLLETPRQAVGPQSPYKFQPARLEP* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,615.084 | ||
Theoretical pI: | 6.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 84.207 | ||
aromaticity | 0.060 | ||
GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.270 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LY581230.1 | internal | 172 | 3-518(+) |
Amino Acid sequence : | |||
TEFDADWLQVIGKLYTKPVVTVGLLPPEEVQIDMSWASAFKWLDLQAAKSVVYVAFGSEAKLTVEQVGEIALGLESSGLKFIWTLRADGLPRGFEERTKDRGMVCKGWIPQTRFLAHSSV GGFLTHGGSSSIVEGLSFGLVMVVLPLLWGQGLNARYLVDKKVGVEVPRNEE | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 11,615.084 | ||
Theoretical pI: | 6.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 84.207 | ||
aromaticity | 0.060 | ||
GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.270 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>LY581230.1 | 5prime_partial | 100 | 518-216(-) |
Amino Acid sequence : | |||
LLISRHLDPNFLVHQIPSIEPLAPQQWQHHHHQPEREPLDYRARPAMCQEPTDRRMSQEPSLWNPALANHSPVLCPLLETPRQAVGPQSPYKFQPARLEP* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,615.084 | ||
Theoretical pI: | 6.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 84.207 | ||
aromaticity | 0.060 | ||
GRAVY | -0.823 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.270 | ||
sheet | 0.280 |