Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF326411.1 | internal | 165 | 3-497(+) |
Amino Acid sequence : | |||
YKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKN | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,361.723 | ||
Theoretical pI: | 6.795 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 27.918 | ||
aromaticity | 0.115 | ||
GRAVY | -0.310 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.230 | ||
sheet | 0.236 |