Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF326414.1 | internal | 170 | 1-510(+) |
Amino Acid sequence : | |||
AGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALR LEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKN | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 18,846.270 | ||
Theoretical pI: | 6.835 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
Instability index: | 27.222 | ||
aromaticity | 0.112 | ||
GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.229 | ||
sheet | 0.241 |