Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF348727.1 | complete | 102 | 74-382(+) |
Amino Acid sequence : | |||
MPHILFYKNKYGAWIPHPCLIYPKLTTRFIIVSRMSRESQSRREFSQFVTYHTIRYINRQMLLSIMNSDCMANHCGYNGRCPRPSYYYFFLLPHVEFLNFSR* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 12,411.371 | ||
Theoretical pI: | 9.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
Instability index: | 61.745 | ||
aromaticity | 0.176 | ||
GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.245 | ||
sheet | 0.176 |