| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF349443.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| SAGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 20,316.817 | ||
| Theoretical pI: | 6.710 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 25.942 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.223 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF349443.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| SAGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 20,316.817 | ||
| Theoretical pI: | 6.710 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 25.942 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.223 | ||
| sheet | 0.261 | ||