| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF379668.1 | internal | 260 | 780-1(-) |
Amino Acid sequence : | |||
| VSSLHLLRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLVNVFVKDFRANLWLVEEPCMHYIRYQGKSILASKGTSLF MNKWKFYLVTSWEWHFLVWFHPRRICINQFSRHSLEIFGYLSNVQTDPSVVRSQILENAFLINNAIRKLDTLVPIIPLIAKLAKEKFCNVLGHPSSKPIWADLSDSNIIDRFGRICRNIS HYHSGSSKKKSLYRIKYILR | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 30,806.597 | ||
| Theoretical pI: | 9.966 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51255 | ||
| Instability index: | 45.385 | ||
| aromaticity | 0.146 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.235 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF379668.1 | internal | 260 | 780-1(-) |
Amino Acid sequence : | |||
| VSSLHLLRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLVNVFVKDFRANLWLVEEPCMHYIRYQGKSILASKGTSLF MNKWKFYLVTSWEWHFLVWFHPRRICINQFSRHSLEIFGYLSNVQTDPSVVRSQILENAFLINNAIRKLDTLVPIIPLIAKLAKEKFCNVLGHPSSKPIWADLSDSNIIDRFGRICRNIS HYHSGSSKKKSLYRIKYILR | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 30,806.597 | ||
| Theoretical pI: | 9.966 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51255 | ||
| Instability index: | 45.385 | ||
| aromaticity | 0.146 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.235 | ||
| sheet | 0.188 | ||