| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF379671.1 | internal | 258 | 776-3(-) |
Amino Acid sequence : | |||
| DVSSLHLLRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLVNVFVKDFRANLRLVEEPCMHYIRYQGKSILASKGTSL FMNKWKFYLVTSWEWHFLVWFHPRRICINQFSRHSLEIFGYLSNVQTDPSVVRSQILENAFLINNAIRKLDTLVPIIPLIAKLAKEKFCNVLGHPSSKPIWADLSDSNIIDRFGRICRNI SHYHSGSSKKKSLYRIKY | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 30,509.159 | ||
| Theoretical pI: | 9.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45755 | ||
| Instability index: | 43.517 | ||
| aromaticity | 0.143 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.407 | ||
| turn | 0.236 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF379671.1 | internal | 258 | 776-3(-) |
Amino Acid sequence : | |||
| DVSSLHLLRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLVNVFVKDFRANLRLVEEPCMHYIRYQGKSILASKGTSL FMNKWKFYLVTSWEWHFLVWFHPRRICINQFSRHSLEIFGYLSNVQTDPSVVRSQILENAFLINNAIRKLDTLVPIIPLIAKLAKEKFCNVLGHPSSKPIWADLSDSNIIDRFGRICRNI SHYHSGSSKKKSLYRIKY | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 30,509.159 | ||
| Theoretical pI: | 9.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45755 | ||
| Instability index: | 43.517 | ||
| aromaticity | 0.143 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.407 | ||
| turn | 0.236 | ||
| sheet | 0.186 | ||