Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF379677.1 | internal | 240 | 720-1(-) |
Amino Acid sequence : | |||
SSLHLLRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSYGVLLERIYFYIKIEHLVNVFVKDFRANLWLIEEPCMHYIRYQGKSILASKGTSLFM NKWKFYLVTSWEWHFLVWFHPRRICINQFSKHSLEIFGYLSNVQTGPSVVRSQILENAFLINNAIKKLDTLVPIIPLIAKLAKEKFCNVLGHPISKPIWADLSDSNIIDRFGRICRNISH | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 28,380.849 | ||
Theoretical pI: | 9.716 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48275 | ||
Instability index: | 41.083 | ||
aromaticity | 0.150 | ||
GRAVY | 0.067 | ||
Secondary Structure Fraction | |||
Helix | 0.425 | ||
turn | 0.229 | ||
sheet | 0.196 |