Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF379681.1 | internal | 240 | 720-1(-) |
Amino Acid sequence : | |||
SSLHLLRVFLNQYCSLITSKKVSSSLSKRNQRFFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLVNVFVKDFRANLWLVEEPCMHYIRYQGKSILASKGTSLFM NKWKFYLVTSWEWHFLVWFHPRRICINQFSRHSLEIFGYLSNVQTDPSVVRSQILENAFLINNAIRKLDTLVPIIPLIAKLAKEKFCNVLGHPSSKPIWADLSDSNIIDRFGRICRNISH | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 28,397.755 | ||
Theoretical pI: | 9.787 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46785 | ||
Instability index: | 44.640 | ||
aromaticity | 0.146 | ||
GRAVY | 0.022 | ||
Secondary Structure Fraction | |||
Helix | 0.417 | ||
turn | 0.233 | ||
sheet | 0.196 |