Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF487808.1 | complete | 193 | 603-22(-) |
Amino Acid sequence : | |||
MEMERDTILPREQLRPYSAKLLFAHYRGGGGFKASPSRITIYKALLQQNSHSRSTIIAYIPAFFPNEGVMIKAVKKLKKALVQKGKKERRFAKGKGHYAIFLPPHHHHHRLAISVAHTPL QLNPQHHHCRRGSKPEQTHEENLENGLQQHYSFHDHLAYPNEGSQEIVAETSSICPTLPGNDSAELGLNNLDA* | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 14,877.254 | ||
Theoretical pI: | 5.656 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 40.270 | ||
aromaticity | 0.119 | ||
GRAVY | 0.440 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.216 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF487808.1 | complete | 134 | 136-540(+) |
Amino Acid sequence : | |||
MIMERVVLLQPIFKIFFMCLFRLGATAAVVVLRVELQWCMSNRDSKAVVVVVGGEENGIMAFAFGESSFFFSFLDQSFFELLHCFDHDALVWKKGGDIGNDCGSTMAVLLQKSFVNGDSA RRGLKTPPTPIVSE* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,877.254 | ||
Theoretical pI: | 5.656 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 40.270 | ||
aromaticity | 0.119 | ||
GRAVY | 0.440 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.216 | ||
sheet | 0.261 |