Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF694772.1 | internal | 126 | 1-378(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRL | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 13,992.650 | ||
Theoretical pI: | 5.462 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
Instability index: | 15.983 | ||
aromaticity | 0.135 | ||
GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.198 | ||
sheet | 0.246 |