Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF694773.1 | internal | 165 | 1-495(+) |
Amino Acid sequence : | |||
YQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTF QGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,329.736 | ||
Theoretical pI: | 8.726 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 21.648 | ||
aromaticity | 0.109 | ||
GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.212 | ||
sheet | 0.242 |