Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>MF694871.1 | internal | 265 | 3-797(+) |
Amino Acid sequence : | |||
TLRYWVKDAPSLHFLRFFLNDYWSLSTPKKAGLKRNQRFFLFLYNSHVCEYESIFVFLRNQSSHLQSLSFGVLLERIYFYGKIECLGSVFLKVTDCQANLWLVKEPCMHYVRYQRKCILS SKGTSLFMNKWKCYLVTFWQWHFSLWFHPRRISTNPLYNHLLEFVGYLSSARMHPAMVRSQILENSFLINNAIKKVDALIPIMPMVTSLAKAQFCNLLGHPTSKPVWADLSDSNIINRFG HICRNISHYYSGSSKKKSLYRIKYI | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 31,356.345 | ||
Theoretical pI: | 9.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66350 66850 | ||
Instability index: | 45.495 | ||
aromaticity | 0.158 | ||
GRAVY | -0.069 | ||
Secondary Structure Fraction | |||
Helix | 0.396 | ||
turn | 0.234 | ||
sheet | 0.211 |