| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >MF694871.1 | internal | 265 | 3-797(+) |
Amino Acid sequence : | |||
| TLRYWVKDAPSLHFLRFFLNDYWSLSTPKKAGLKRNQRFFLFLYNSHVCEYESIFVFLRNQSSHLQSLSFGVLLERIYFYGKIECLGSVFLKVTDCQANLWLVKEPCMHYVRYQRKCILS SKGTSLFMNKWKCYLVTFWQWHFSLWFHPRRISTNPLYNHLLEFVGYLSSARMHPAMVRSQILENSFLINNAIKKVDALIPIMPMVTSLAKAQFCNLLGHPTSKPVWADLSDSNIINRFG HICRNISHYYSGSSKKKSLYRIKYI | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 31,356.345 | ||
| Theoretical pI: | 9.793 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66350 66850 | ||
| Instability index: | 45.495 | ||
| aromaticity | 0.158 | ||
| GRAVY | -0.069 | ||
Secondary Structure Fraction | |||
| Helix | 0.396 | ||
| turn | 0.234 | ||
| sheet | 0.211 | ||